General Information

  • ID:  hor006361
  • Uniprot ID:  O77801
  • Protein name:  Insulin-like 3 B' chain
  • Gene name:  INSL3
  • Organism:  Bos taurus (Bovine)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed exclusively in Leydig cells of the testis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0002020 protease binding; GO:0005179 hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0010634 positive regulation of epithelial cell migration; GO:0090303 positive regulation of wound healing
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPAAAQEAPEKLCGHHFVRALVRLCGGPRWSSEEDGRPVAGGDRE
  • Length:  45(22-66)
  • Propeptide:  MDRRPLTWALVLLGPALAIALGPAAAQEAPEKLCGHHFVRALVRLCGGPRWSSEEDGRPVAGGDRELLRWLEGQHLLHGLMASGDPVLVLAPQPLPQASRHHHHRRATAINPARHCCLSGCTRQDLLTLCPH
  • Signal peptide:  MDRRPLTWALVLLGPALAIAL
  • Modification:  T6 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:  E1BKC2, F1MI30
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O77801-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006361_AF2.pdbhor006361_ESM.pdb

Physical Information

Mass: 555531 Formula: C203H319N67O63S2
Absent amino acids: IMNTY Common amino acids: G
pI: 6.5 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -66.44 Boman Index: -10111
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 58.67
Instability Index: 6579.56 Extinction Coefficient cystines: 5625
Absorbance 280nm: 127.84

Literature

  • PubMed ID:  8949906
  • Title:  Relaxin-like factor gene is highly expressed in the bovine ovary of the cycle and pregnancy: sequence and messenger ribonucleic acid analysis.
  • PubMed ID:  11772026
  • Title:  The primary structure and the disulfide links of the bovine relaxin-like factor (RLF).